UBE2NL Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: UBE2NL Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A8381
• Hersteller Artikelnummer: A8381
• Alternativnummer: ABB-A8381-20UL,ABB-A8381-100UL,ABB-A8381-500UL,ABB-A8381-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Li174, UBE2NL

Produktbeschreibung

This gene is intronless and encodes a member of the ubiquitin-conjugating enzyme family. The protein product is 91% identical to ubiquitin-conjugating enzyme E2N, a multi-exon gene product. This locus represents a polymorphic pseudogene, where some individuals contain an allele that can encode a full-length protein, while others have a non-functional allele containing a premature stop codon (reference SNP rs237520) that truncates the coding sequence.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 17kDa
• NCBI: 389898
• UniProt: Q5JXB2
• Reinheit: Affinity purification
• Sequenz: MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPAL
• Target-Kategorie: UBE2NL
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using UBE2NL Rabbit pAb (A8381) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.