UBE2NL Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: UBE2NL Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8381
• Supplier Catalog Number: A8381
• Alternative Catalog Number: ABB-A8381-20UL,ABB-A8381-100UL,ABB-A8381-500UL,ABB-A8381-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Li174, UBE2NL

Product Description

This gene is intronless and encodes a member of the ubiquitin-conjugating enzyme family. The protein product is 91% identical to ubiquitin-conjugating enzyme E2N, a multi-exon gene product. This locus represents a polymorphic pseudogene, where some individuals contain an allele that can encode a full-length protein, while others have a non-functional allele containing a premature stop codon (reference SNP rs237520) that truncates the coding sequence.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 389898
• UniProt: Q5JXB2
• Purity: Affinity purification
• Sequence: MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTKIYHPNVDKLERISLDILKDKWSPAL
• Target: UBE2NL
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of various lysates using UBE2NL Rabbit pAb (A8381) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.