GNG10 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: GNG10 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8423
• Hersteller Artikelnummer: A8423
• Alternativnummer: ABB-A8423-20UL,ABB-A8423-100UL,ABB-A8423-1000UL,ABB-A8423-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GNG10

Produktbeschreibung

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 7kDa
• NCBI: 2790
• UniProt: P50151
• Reinheit: Affinity purification
• Sequenz: MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
• Target-Kategorie: GNG10
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,mTOR Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease.

Bilder

Western blot analysis of various lysates using GNG10 Rabbit pAb (A8423) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.