GNG10 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: GNG10 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A8423
• Supplier Catalog Number: A8423
• Alternative Catalog Number: ABB-A8423-20UL,ABB-A8423-100UL,ABB-A8423-1000UL,ABB-A8423-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GNG10

Product Description

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 7kDa
• NCBI: 2790
• UniProt: P50151
• Purity: Affinity purification
• Sequence: MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
• Target: GNG10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,mTOR Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag

Images

Western blot analysis of various lysates using GNG10 Rabbit pAb (A8423) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.