ATG2B Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ATG2B Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8498
• Hersteller Artikelnummer: A8498
• Alternativnummer: ABB-A8498-100UL,ABB-A8498-20UL,ABB-A8498-1000UL,ABB-A8498-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BLTP4B, C14orf103, ATG2B

Produktbeschreibung

This gene encodes a protein required for autophagy. The encoded protein is involved in autophagosome formation. A germline duplication of a region that includes this gene is associated with predisposition to myeloid malignancies.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 233kDa
• NCBI: 55102
• UniProt: Q96BY7
• Reinheit: Affinity purification
• Sequenz: IQYIASYGDLQTPNKADMKPGAFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEKSQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLYGGKDFGTVPPTSPAKSYISPHSSPSHTPTRHGRNTVCGGK
• Target-Kategorie: ATG2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Cardiovascular,Heart.

Bilder

Western blot analysis of various lysates using ATG2B Rabbit pAb (A8498) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.