ATG2B Rabbit pAb, Unconjugated

Product Overview

• Article Name: ATG2B Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8498
• Supplier Catalog Number: A8498
• Alternative Catalog Number: ABB-A8498-100UL,ABB-A8498-20UL,ABB-A8498-1000UL,ABB-A8498-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BLTP4B, C14orf103, ATG2B

Product Description

This gene encodes a protein required for autophagy. The encoded protein is involved in autophagosome formation. A germline duplication of a region that includes this gene is associated with predisposition to myeloid malignancies.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 233kDa
• NCBI: 55102
• UniProt: Q96BY7
• Purity: Affinity purification
• Sequence: IQYIASYGDLQTPNKADMKPGAFQRRSKVDSSGRSSSRGPVLPEADQQMLRDLMSDAMEEIDMQQGTSSVKPQANGVLDEKSQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLYGGKDFGTVPPTSPAKSYISPHSSPSHTPTRHGRNTVCGGK
• Target: ATG2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Cardiovascular,Heart.

Images

Western blot analysis of various lysates using ATG2B Rabbit pAb (A8498) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.