PRDM11 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: PRDM11 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8502
• Hersteller Artikelnummer: A8502
• Alternativnummer: ABB-A8502-20UL,ABB-A8502-100UL,ABB-A8502-500UL,ABB-A8502-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PFM8, PRDM11

Produktbeschreibung

Predicted to enable chromatin binding activity. Involved in several processes, including negative regulation of cell growth, positive regulation of fibroblast apoptotic process, and regulation of transcription, DNA-templated. Located in cytosol and nucleus.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 58kDa
• NCBI: 56981
• UniProt: Q9NQV5
• Reinheit: Affinity purification
• Sequenz: DYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPEDLRGPIHLSVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFKDVLEASLESAKVEAHQLALSTSLVIRKVPKYQDDAYSQCATTMTHGVQNIGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPEPPVLPPQVLELPEFSDPAGKLVWMRLLSEGRVRSGLCGG
• Target-Kategorie: PRDM11
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors.

Bilder

Western blot analysis of various lysates using PRDM11 Rabbit pAb (A8502) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.