PRDM11 Rabbit pAb, Unconjugated

Product Overview

• Article Name: PRDM11 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8502
• Supplier Catalog Number: A8502
• Alternative Catalog Number: ABB-A8502-20UL,ABB-A8502-100UL,ABB-A8502-500UL,ABB-A8502-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PFM8, PRDM11

Product Description

Predicted to enable chromatin binding activity. Involved in several processes, including negative regulation of cell growth, positive regulation of fibroblast apoptotic process, and regulation of transcription, DNA-templated. Located in cytosol and nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 58kDa
• NCBI: 56981
• UniProt: Q9NQV5
• Purity: Affinity purification
• Sequence: DYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPEDLRGPIHLSVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFKDVLEASLESAKVEAHQLALSTSLVIRKVPKYQDDAYSQCATTMTHGVQNIGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPEPPVLPPQVLELPEFSDPAGKLVWMRLLSEGRVRSGLCGG
• Target: PRDM11
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor suppressors.

Images

Western blot analysis of various lysates using PRDM11 Rabbit pAb (A8502) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.