MTERFD3 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MTERFD3 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8518
• Hersteller Artikelnummer: A8518
• Alternativnummer: ABB-A8518-20UL,ABB-A8518-100UL,ABB-A8518-1000UL,ABB-A8518-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: mTERFL, MTERFD3

Produktbeschreibung

Enables DNA binding activity. Predicted to be involved in termination of mitochondrial transcription. Located in mitochondrion.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 44kDa
• NCBI: 80298
• UniProt: Q49AM1
• Reinheit: Affinity purification
• Sequenz: MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVEKLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGGSEANMKVWLLKLLSQNPFILLNSPTAIKETLEFLQEQGFTSFEILQLLSK
• Target-Kategorie: MTERF2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism.

Bilder

Western blot analysis of various lysates using MTERFD3 Rabbit pAb (A8518) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.