MTERFD3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A8518
Article Name: MTERFD3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A8518
Supplier Catalog Number: A8518
Alternative Catalog Number: ABB-A8518-20UL,ABB-A8518-100UL,ABB-A8518-1000UL,ABB-A8518-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: mTERFL, MTERFD3
Enables DNA binding activity. Predicted to be involved in termination of mitochondrial transcription. Located in mitochondrion.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 80298
UniProt: Q49AM1
Purity: Affinity purification
Sequence: MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVEKLYKCSVDIRKIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGGSEANMKVWLLKLLSQNPFILLNSPTAIKETLEFLQEQGFTSFEILQLLSK
Target: MTERF2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism.
Western blot analysis of various lysates using MTERFD3 Rabbit pAb (A8518) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.