GPRC6A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: GPRC6A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8525
• Hersteller Artikelnummer: A8525
• Alternativnummer: ABB-A8525-100UL,ABB-A8525-20UL,ABB-A8525-500UL,ABB-A8525-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GPCR, bA86F4.3, GPRC6A

Produktbeschreibung

Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain (summary by Pi et al., 2005 [PubMed 16199532]).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 105kDa
• NCBI: 222545
• UniProt: Q5T6X5
• Reinheit: Affinity purification
• Sequenz: IASDNWSTATKITTIPNVKKIGKVVGFAFRRGNISSFHSFLQNLHLLPSDSHKLLHEYAMHLSACAYVKDTDLSQCIFNHSQRTLAYKANKAIERNFVMRNDFLWDYAEPGLIHSIQLAVFALGYAIRDLCQARDCQNPNAFQPWELLGVLKNVTFTDGWNSFHFDAHGDLNTGYDVVLWKEINGHMTVTKMAEYDLQNDVFIIPDQETKNEFRNLKQIQSKCSKECSPGQMKKTTRSQHICCYECQNCPENHYT
• Target-Kategorie: GPRC6A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience.

Bilder

Western blot analysis of various lysates using GPRC6A Rabbit pAb (A8525) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.