GPRC6A Rabbit pAb, Unconjugated

Product Overview

• Article Name: GPRC6A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8525
• Supplier Catalog Number: A8525
• Alternative Catalog Number: ABB-A8525-100UL,ABB-A8525-20UL,ABB-A8525-500UL,ABB-A8525-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GPCR, bA86F4.3, GPRC6A

Product Description

Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain (summary by Pi et al., 2005 [PubMed 16199532]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 105kDa
• NCBI: 222545
• UniProt: Q5T6X5
• Purity: Affinity purification
• Sequence: IASDNWSTATKITTIPNVKKIGKVVGFAFRRGNISSFHSFLQNLHLLPSDSHKLLHEYAMHLSACAYVKDTDLSQCIFNHSQRTLAYKANKAIERNFVMRNDFLWDYAEPGLIHSIQLAVFALGYAIRDLCQARDCQNPNAFQPWELLGVLKNVTFTDGWNSFHFDAHGDLNTGYDVVLWKEINGHMTVTKMAEYDLQNDVFIIPDQETKNEFRNLKQIQSKCSKECSPGQMKKTTRSQHICCYECQNCPENHYT
• Target: GPRC6A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience.

Images

Western blot analysis of various lysates using GPRC6A Rabbit pAb (A8525) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.