NOX1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NOX1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8527
• Hersteller Artikelnummer: A8527
• Alternativnummer: ABB-A8527-20UL,ABB-A8527-100UL,ABB-A8527-500UL,ABB-A8527-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MOX1, NOH1, NOH-1, GP91-2, NOH-1L, NOX1

Produktbeschreibung

This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 65kDa
• NCBI: 27035
• UniProt: Q9Y5S8
• Reinheit: Affinity purification
• Sequenz: RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPF
• Target-Kategorie: NOX1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Nucleotide metabolism,Immunology Inflammation.

Bilder

Western blot analysis of various lysates using NOX1 Rabbit pAb (A8527) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.