NOX1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: NOX1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8527
• Supplier Catalog Number: A8527
• Alternative Catalog Number: ABB-A8527-20UL,ABB-A8527-100UL,ABB-A8527-500UL,ABB-A8527-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MOX1, NOH1, NOH-1, GP91-2, NOH-1L, NOX1

Product Description

This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 65kDa
• NCBI: 27035
• UniProt: Q9Y5S8
• Purity: Affinity purification
• Sequence: RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPF
• Target: NOX1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Nucleotide metabolism,Immunology Inflammation.

Images

Western blot analysis of various lysates using NOX1 Rabbit pAb (A8527) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.