ADRA2B Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ADRA2B Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8535
• Hersteller Artikelnummer: A8535
• Alternativnummer: ABB-A8535-20UL,ABB-A8535-100UL,ABB-A8535-500UL,ABB-A8535-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FAME2, ADRA2L1, ADRARL1, ADRA2RL1, ALPHA2BAR, alpha-2BAR, ADRA2B

Produktbeschreibung

This intronless gene encodes a seven-pass transmembrane protein. This protein is a member of a subfamily of G protein-coupled receptors that regulate neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 50kDa
• NCBI: 151
• UniProt: P18089
• Reinheit: Affinity purification
• Sequenz: MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSI
• Target-Kategorie: ADRA2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway.

Bilder

Western blot analysis of various lysates using ADRA2B Rabbit pAb (A8535) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.