ADRA2B Rabbit pAb, Unconjugated

Product Overview

• Article Name: ADRA2B Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8535
• Supplier Catalog Number: A8535
• Alternative Catalog Number: ABB-A8535-20UL,ABB-A8535-100UL,ABB-A8535-500UL,ABB-A8535-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FAME2, ADRA2L1, ADRARL1, ADRA2RL1, ALPHA2BAR, alpha-2BAR, ADRA2B

Product Description

This intronless gene encodes a seven-pass transmembrane protein. This protein is a member of a subfamily of G protein-coupled receptors that regulate neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 151
• UniProt: P18089
• Purity: Affinity purification
• Sequence: MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSI
• Target: ADRA2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,AMPK Signaling Pathway.

Images

Western blot analysis of various lysates using ADRA2B Rabbit pAb (A8535) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.