TPPP/p25 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: TPPP/p25 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8574
• Hersteller Artikelnummer: A8574
• Alternativnummer: ABB-A8574-100UL,ABB-A8574-20UL,ABB-A8574-1000UL,ABB-A8574-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: p24, p25, TPPP1, TPPP/p25, p25alpha

Produktbeschreibung

Enables several functions, including GTPase activity, magnesium ion binding activity, and protein homodimerization activity. Involved in several processes, including microtubule cytoskeleton organization, negative regulation of tubulin deacetylation, and positive regulation of protein polymerization. Located in several cellular components, including mitochondrion, mitotic spindle, and perinuclear region of cytoplasm. Colocalizes with microtubule and microtubule bundle.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 24kDa
• NCBI: 11076
• UniProt: O94811
• Reinheit: Affinity purification
• Sequenz: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
• Target-Kategorie: TPPP
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microtubules.

Bilder

Western blot analysis of various lysates using TPPP/p25 Rabbit pAb (A8574) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.