TPPP/p25 Rabbit pAb, Unconjugated

Product Overview

• Article Name: TPPP/p25 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8574
• Supplier Catalog Number: A8574
• Alternative Catalog Number: ABB-A8574-100UL,ABB-A8574-20UL,ABB-A8574-1000UL,ABB-A8574-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: p24, p25, TPPP1, TPPP/p25, p25alpha

Product Description

Enables several functions, including GTPase activity, magnesium ion binding activity, and protein homodimerization activity. Involved in several processes, including microtubule cytoskeleton organization, negative regulation of tubulin deacetylation, and positive regulation of protein polymerization. Located in several cellular components, including mitochondrion, mitotic spindle, and perinuclear region of cytoplasm. Colocalizes with microtubule and microtubule bundle.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 11076
• UniProt: O94811
• Purity: Affinity purification
• Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
• Target: TPPP
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microtubules.

Images

Western blot analysis of various lysates using TPPP/p25 Rabbit pAb (A8574) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.