ATG2A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ATG2A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8576
• Hersteller Artikelnummer: A8576
• Alternativnummer: ABB-A8576-100UL,ABB-A8576-20UL,ABB-A8576-1000UL,ABB-A8576-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BLTP4A, ATG2A

Produktbeschreibung

Predicted to enable phosphatidylinositol-3-phosphate binding activity. Involved in autophagosome assembly. Predicted to be located in endoplasmic reticulum membrane, lipid droplet, and phagophore assembly site membrane. Predicted to be active in phagophore assembly site. Predicted to be extrinsic component of membrane.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 213kDa
• NCBI: 23130
• UniProt: Q2TAZ0
• Reinheit: Affinity purification
• Sequenz: DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT
• Target-Kategorie: ATG2A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Endocrine Metabolism,Mitochondrial metabolism.

Bilder

Western blot analysis of various lysates using ATG2A Rabbit pAb (A8576) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.