ATG2A Rabbit pAb, Unconjugated

Product Overview

• Article Name: ATG2A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8576
• Supplier Catalog Number: A8576
• Alternative Catalog Number: ABB-A8576-100UL,ABB-A8576-20UL,ABB-A8576-1000UL,ABB-A8576-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BLTP4A, ATG2A

Product Description

Predicted to enable phosphatidylinositol-3-phosphate binding activity. Involved in autophagosome assembly. Predicted to be located in endoplasmic reticulum membrane, lipid droplet, and phagophore assembly site membrane. Predicted to be active in phagophore assembly site. Predicted to be extrinsic component of membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 213kDa
• NCBI: 23130
• UniProt: Q2TAZ0
• Purity: Affinity purification
• Sequence: DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT
• Target: ATG2A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Endocrine Metabolism,Mitochondrial metabolism.

Images

Western blot analysis of various lysates using ATG2A Rabbit pAb (A8576) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.