ERBB2IP Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ERBB2IP Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8585
• Hersteller Artikelnummer: A8585
• Alternativnummer: ABB-A8585-20UL,ABB-A8585-100UL,ABB-A8585-1000UL,ABB-A8585-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LAP2, ERBB2IP, HEL-S-78

Produktbeschreibung

This gene is a member of the leucine-rich repeat and PDZ domain (LAP) family. The encoded protein contains 17 leucine-rich repeats and one PDZ domain. It binds to the unphosphorylated form of the ERBB2 protein and regulates ERBB2 function and localization. It has also been shown to affect the Ras signaling pathway by disrupting Ras-Raf interaction. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 158kDa
• NCBI: 55914
• UniProt: Q96RT1
• Reinheit: Affinity purification
• Sequenz: IPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPRDWREQVLRHIEAKKLEKMPLSNGQMGQPLRPQANYSQIHHPPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
• Target-Kategorie: ERBIN
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Immunology Inflammation,Cytokines.

Bilder

Western blot analysis of various lysates using ERBB2IP Rabbit pAb (A8585) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.