ERBB2IP Rabbit pAb, Unconjugated

Product Overview

• Article Name: ERBB2IP Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8585
• Supplier Catalog Number: A8585
• Alternative Catalog Number: ABB-A8585-20UL,ABB-A8585-100UL,ABB-A8585-1000UL,ABB-A8585-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LAP2, ERBB2IP, HEL-S-78

Product Description

This gene is a member of the leucine-rich repeat and PDZ domain (LAP) family. The encoded protein contains 17 leucine-rich repeats and one PDZ domain. It binds to the unphosphorylated form of the ERBB2 protein and regulates ERBB2 function and localization. It has also been shown to affect the Ras signaling pathway by disrupting Ras-Raf interaction. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 158kDa
• NCBI: 55914
• UniProt: Q96RT1
• Purity: Affinity purification
• Sequence: IPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVPRDWREQVLRHIEAKKLEKMPLSNGQMGQPLRPQANYSQIHHPPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
• Target: ERBIN
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Immunology Inflammation,Cytokines.

Images

Western blot analysis of various lysates using ERBB2IP Rabbit pAb (A8585) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.