GATC Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: GATC Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8604
• Hersteller Artikelnummer: A8604
• Alternativnummer: ABB-A8604-20UL,ABB-A8604-100UL,ABB-A8604-500UL,ABB-A8604-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: 15E1.2, COXPD42, GATC

Produktbeschreibung

Enables glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. Involved in glutaminyl-tRNAGln biosynthesis via transamidation and mitochondrial translation. Located in mitochondrion. Part of glutamyl-tRNA(Gln) amidotransferase complex. Implicated in combined oxidative phosphorylation deficiency 42.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 15kDa
• NCBI: 283459
• UniProt: O43716
• Reinheit: Affinity purification
• Sequenz: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
• Target-Kategorie: GATC
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Endocrine Metabolism,Mitochondrial metabolism.

Bilder

Western blot analysis of various lysates using GATC Rabbit pAb (A8604) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.