GATC Rabbit pAb, Unconjugated

Product Overview

• Article Name: GATC Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8604
• Supplier Catalog Number: A8604
• Alternative Catalog Number: ABB-A8604-20UL,ABB-A8604-100UL,ABB-A8604-500UL,ABB-A8604-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 15E1.2, COXPD42, GATC

Product Description

Enables glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. Involved in glutaminyl-tRNAGln biosynthesis via transamidation and mitochondrial translation. Located in mitochondrion. Part of glutamyl-tRNA(Gln) amidotransferase complex. Implicated in combined oxidative phosphorylation deficiency 42.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 15kDa
• NCBI: 283459
• UniProt: O43716
• Purity: Affinity purification
• Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
• Target: GATC
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Endocrine Metabolism,Mitochondrial metabolism.

Images

Western blot analysis of various lysates using GATC Rabbit pAb (A8604) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.