TMPRSS11A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: TMPRSS11A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8605
• Hersteller Artikelnummer: A8605
• Alternativnummer: ABB-A8605-20UL,ABB-A8605-100UL,ABB-A8605-500UL,ABB-A8605-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HESP, ECRG1, HATL1, TMPRSS11A

Produktbeschreibung

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in proteolysis. Predicted to be located in extracellular region. Predicted to be integral component of plasma membrane.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 47kDa
• NCBI: 339967
• UniProt: Q6ZMR5
• Reinheit: Affinity purification
• Sequenz: SASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKTGI
• Target-Kategorie: TMPRSS11A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Apoptosis,Ubiquitin.

Bilder

Western blot analysis of various lysates using TMPRSS11A Rabbit pAb (A8605) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.