TMPRSS11A Rabbit pAb, Unconjugated

Product Overview

• Article Name: TMPRSS11A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8605
• Supplier Catalog Number: A8605
• Alternative Catalog Number: ABB-A8605-20UL,ABB-A8605-100UL,ABB-A8605-500UL,ABB-A8605-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HESP, ECRG1, HATL1, TMPRSS11A

Product Description

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in proteolysis. Predicted to be located in extracellular region. Predicted to be integral component of plasma membrane.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 47kDa
• NCBI: 339967
• UniProt: Q6ZMR5
• Purity: Affinity purification
• Sequence: SASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKTGI
• Target: TMPRSS11A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Apoptosis,Ubiquitin.

Images

Western blot analysis of various lysates using TMPRSS11A Rabbit pAb (A8605) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.