CD320 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CD320 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8627
• Hersteller Artikelnummer: A8627
• Alternativnummer: ABB-A8627-20UL,ABB-A8627-100UL,ABB-A8627-1000UL,ABB-A8627-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: 8D6, 8D6A, TCBLR, TCN2R, TCII-R, sCD320, CD320

Produktbeschreibung

This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 29kDa
• NCBI: 51293
• UniProt: Q9NPF0
• Reinheit: Affinity purification
• Sequenz: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY
• Target-Kategorie: CD320
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Growth factors,Immunology Inflammation,CDs.

Bilder

Western blot analysis of lysates from U-251MG cells, using CD320 Rabbit pAb (A8627) at 1:2500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.