CD320 Rabbit pAb, Unconjugated

Product Overview

• Article Name: CD320 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8627
• Supplier Catalog Number: A8627
• Alternative Catalog Number: ABB-A8627-20UL,ABB-A8627-100UL,ABB-A8627-1000UL,ABB-A8627-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: 8D6, 8D6A, TCBLR, TCN2R, TCII-R, sCD320, CD320

Product Description

This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 29kDa
• NCBI: 51293
• UniProt: Q9NPF0
• Purity: Affinity purification
• Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY
• Target: CD320
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Growth factors,Immunology Inflammation,CDs.

Images

Western blot analysis of lysates from U-251MG cells, using CD320 Rabbit pAb (A8627) at 1:2500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.