PFDN1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: PFDN1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8681
• Hersteller Artikelnummer: A8681
• Alternativnummer: ABB-A8681-20UL,ABB-A8681-100UL,ABB-A8681-1000UL,ABB-A8681-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PDF, PFD1, PFDN1

Produktbeschreibung

This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 14kDa
• NCBI: 5201
• UniProt: O60925
• Reinheit: Affinity purification
• Sequenz: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
• Target-Kategorie: PFDN1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction.

Bilder

Western blot analysis of various lysates using PFDN1 Rabbit pAb (A8681) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.