PFDN1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: PFDN1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8681
• Supplier Catalog Number: A8681
• Alternative Catalog Number: ABB-A8681-20UL,ABB-A8681-100UL,ABB-A8681-1000UL,ABB-A8681-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PDF, PFD1, PFDN1

Product Description

This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 14kDa
• NCBI: 5201
• UniProt: O60925
• Purity: Affinity purification
• Sequence: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
• Target: PFDN1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction.

Images

Western blot analysis of various lysates using PFDN1 Rabbit pAb (A8681) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.