FNTA Rabbit pAb, Unconjugated

Artikelnummer: ABB-A8805
Artikelname: FNTA Rabbit pAb, Unconjugated
Artikelnummer: ABB-A8805
Hersteller Artikelnummer: A8805
Alternativnummer: ABB-A8805-100UL,ABB-A8805-20UL,ABB-A8805-1000UL,ABB-A8805-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FPTA, PTAR2, PGGT1A, FNTA
Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13.
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 2339
UniProt: P49354
Reinheit: Affinity purification
Sequenz: LKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
Target-Kategorie: FNTA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology.
Western blot analysis of various lysates using FNTA Rabbit pAb (A8805) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.