FNTA Rabbit pAb, Unconjugated

Catalog Number: ABB-A8805
Article Name: FNTA Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A8805
Supplier Catalog Number: A8805
Alternative Catalog Number: ABB-A8805-100UL,ABB-A8805-20UL,ABB-A8805-1000UL,ABB-A8805-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FPTA, PTAR2, PGGT1A, FNTA
Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 2339
UniProt: P49354
Purity: Affinity purification
Sequence: LKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
Target: FNTA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology.
Western blot analysis of various lysates using FNTA Rabbit pAb (A8805) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.