DDT Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: DDT Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8816
• Hersteller Artikelnummer: A8816
• Alternativnummer: ABB-A8816-100UL,ABB-A8816-20UL,ABB-A8816-500UL,ABB-A8816-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: D-DT, DDCT, MIF2, MIF-2, DDT

Produktbeschreibung

D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 13kDa
• NCBI: 1652
• UniProt: P30046
• Reinheit: Affinity purification
• Sequenz: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
• Target-Kategorie: DDT
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology.

Bilder

Western blot analysis of various lysates using DDT Rabbit pAb (A8816) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.