DDT Rabbit pAb, Unconjugated

Product Overview

• Article Name: DDT Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8816
• Supplier Catalog Number: A8816
• Alternative Catalog Number: ABB-A8816-100UL,ABB-A8816-20UL,ABB-A8816-500UL,ABB-A8816-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: D-DT, DDCT, MIF2, MIF-2, DDT

Product Description

D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 13kDa
• NCBI: 1652
• UniProt: P30046
• Purity: Affinity purification
• Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
• Target: DDT
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology.

Images

Western blot analysis of various lysates using DDT Rabbit pAb (A8816) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.