SNRPB2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: SNRPB2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A8908
• Hersteller Artikelnummer: A8908
• Alternativnummer: ABB-A8908-20UL,ABB-A8908-100UL,ABB-A8908-1000UL,ABB-A8908-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Msl1, U2B, SNRPB2

Produktbeschreibung

The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 25kDa
• NCBI: 6629
• UniProt: P08579
• Reinheit: Affinity purification
• Sequenz: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPN
• Target-Kategorie: SNRPB2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat

Bilder

Western blot analysis of various lysates using SNRPB2 Rabbit pAb (A8908) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.