SNRPB2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: SNRPB2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A8908
• Supplier Catalog Number: A8908
• Alternative Catalog Number: ABB-A8908-20UL,ABB-A8908-100UL,ABB-A8908-1000UL,ABB-A8908-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Msl1, U2B, SNRPB2

Product Description

The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 25kDa
• NCBI: 6629
• UniProt: P08579
• Purity: Affinity purification
• Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPN
• Target: SNRPB2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat

Images

Western blot analysis of various lysates using SNRPB2 Rabbit pAb (A8908) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.