TCF7L1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: TCF7L1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9006
• Hersteller Artikelnummer: A9006
• Alternativnummer: ABB-A9006-100UL,ABB-A9006-20UL,ABB-A9006-1000UL,ABB-A9006-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TCF3, TCF-3, TCF7L1

Produktbeschreibung

This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 63kDa
• NCBI: 83439
• UniProt: Q9HCS4
• Reinheit: Affinity purification
• Sequenz: YSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEE
• Target-Kategorie: TCF7L1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Wnt -Catenin Signaling Pathway,Stem Cells.

Bilder

Western blot analysis of various lysates using TCF7L1 Rabbit pAb (A9006) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.