TCF7L1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: TCF7L1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9006
• Supplier Catalog Number: A9006
• Alternative Catalog Number: ABB-A9006-100UL,ABB-A9006-20UL,ABB-A9006-1000UL,ABB-A9006-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TCF3, TCF-3, TCF7L1

Product Description

This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor beta signaling pathway. The encoded protein contains a high mobility group-box DNA binding domain and participates in the regulation of cell cycle genes and cellular senescence.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 63kDa
• NCBI: 83439
• UniProt: Q9HCS4
• Purity: Affinity purification
• Sequence: YSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEE
• Target: TCF7L1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Wnt -Catenin Signaling Pathway,Stem Cells.

Images

Western blot analysis of various lysates using TCF7L1 Rabbit pAb (A9006) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.