MYO18A Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MYO18A Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9015
• Hersteller Artikelnummer: A9015
• Alternativnummer: ABB-A9015-100UL,ABB-A9015-20UL,ABB-A9015-500UL,ABB-A9015-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MAJN, TIAF1, MYSPDZ, SPR210, SP-R210, MYO18A

Produktbeschreibung

The protein encoded by this gene can bind GOLPH3, linking the Golgi to the cytoskeleton and influencing Golgi membrane trafficking. The encoded protein is also part of a complex that assembles lamellar actomyosin bundles and may be required for cell migration.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 233kDa
• NCBI: 399687
• UniProt: Q92614
• Reinheit: Affinity purification
• Sequenz: SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA
• Target-Kategorie: MYO18A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cytoskeleton,Motor Proteins.

Bilder

Western blot analysis of various lysates using MYO18A Rabbit pAb (A9015) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.