MYO18A Rabbit pAb, Unconjugated

Product Overview

• Article Name: MYO18A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9015
• Supplier Catalog Number: A9015
• Alternative Catalog Number: ABB-A9015-100UL,ABB-A9015-20UL,ABB-A9015-500UL,ABB-A9015-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MAJN, TIAF1, MYSPDZ, SPR210, SP-R210, MYO18A

Product Description

The protein encoded by this gene can bind GOLPH3, linking the Golgi to the cytoskeleton and influencing Golgi membrane trafficking. The encoded protein is also part of a complex that assembles lamellar actomyosin bundles and may be required for cell migration.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 233kDa
• NCBI: 399687
• UniProt: Q92614
• Purity: Affinity purification
• Sequence: SDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA
• Target: MYO18A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cytoskeleton,Motor Proteins.

Images

Western blot analysis of various lysates using MYO18A Rabbit pAb (A9015) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.