NAGK Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NAGK Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9070
• Hersteller Artikelnummer: A9070
• Alternativnummer: ABB-A9070-20UL,ABB-A9070-100UL,ABB-A9070-500UL,ABB-A9070-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GNK, HSA242910, NAGK

Produktbeschreibung

This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 37kDa
• NCBI: 55577
• UniProt: Q9UJ70
• Reinheit: Affinity purification
• Sequenz: IYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAV
• Target-Kategorie: NAGK
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Endocrine Metabolism.

Bilder

Western blot analysis of various lysates using NAGK Rabbit pAb (A9070) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.