NAGK Rabbit pAb, Unconjugated

Product Overview

• Article Name: NAGK Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9070
• Supplier Catalog Number: A9070
• Alternative Catalog Number: ABB-A9070-20UL,ABB-A9070-100UL,ABB-A9070-500UL,ABB-A9070-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: GNK, HSA242910, NAGK

Product Description

This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 37kDa
• NCBI: 55577
• UniProt: Q9UJ70
• Purity: Affinity purification
• Sequence: IYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAV
• Target: NAGK
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Endocrine Metabolism.

Images

Western blot analysis of various lysates using NAGK Rabbit pAb (A9070) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.