NUP160 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NUP160 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9161
• Hersteller Artikelnummer: A9161
• Alternativnummer: ABB-A9161-100UL,ABB-A9161-20UL,ABB-A9161-500UL,ABB-A9161-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NPHS19, NUP160

Produktbeschreibung

A structural constituent of nuclear pore. Involved in mRNA export from nucleus and nephron development. Part of nuclear pore outer ring. Colocalizes with kinetochore. Implicated in nephrotic syndrome type 19.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 162kDa
• NCBI: 23279
• UniProt: Q12769
• Reinheit: Affinity purification
• Sequenz: ALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNR
• Target-Kategorie: NUP160
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle.

Bilder

Western blot analysis of various lysates using NUP160 Rabbit pAb (A9161) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.