NUP160 Rabbit pAb, Unconjugated

Product Overview

• Article Name: NUP160 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9161
• Supplier Catalog Number: A9161
• Alternative Catalog Number: ABB-A9161-100UL,ABB-A9161-20UL,ABB-A9161-500UL,ABB-A9161-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NPHS19, NUP160

Product Description

A structural constituent of nuclear pore. Involved in mRNA export from nucleus and nephron development. Part of nuclear pore outer ring. Colocalizes with kinetochore. Implicated in nephrotic syndrome type 19.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 162kDa
• NCBI: 23279
• UniProt: Q12769
• Purity: Affinity purification
• Sequence: ALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNR
• Target: NUP160
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle.

Images

Western blot analysis of various lysates using NUP160 Rabbit pAb (A9161) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.