RPL26L1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: RPL26L1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9192
• Hersteller Artikelnummer: A9192
• Alternativnummer: ABB-A9192-20UL,ABB-A9192-100UL,ABB-A9192-1000UL,ABB-A9192-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RPL26P1, RPL26L1

Produktbeschreibung

This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 17kDa
• NCBI: 51121
• UniProt: Q9UNX3
• Reinheit: Affinity purification
• Sequenz: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
• Target-Kategorie: RPL26L1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology.

Bilder

Western blot analysis of various lysates using RPL26L1 Rabbit pAb (A9192) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.