RPL26L1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: RPL26L1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9192
• Supplier Catalog Number: A9192
• Alternative Catalog Number: ABB-A9192-20UL,ABB-A9192-100UL,ABB-A9192-1000UL,ABB-A9192-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RPL26P1, RPL26L1

Product Description

This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. Alternative splicing results in multiple transcript variants encoding the same protein.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa
• NCBI: 51121
• UniProt: Q9UNX3
• Purity: Affinity purification
• Sequence: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
• Target: RPL26L1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology.

Images

Western blot analysis of various lysates using RPL26L1 Rabbit pAb (A9192) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.