GLOD4 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: GLOD4 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9216
• Hersteller Artikelnummer: A9216
• Alternativnummer: ABB-A9216-20UL,ABB-A9216-100UL,ABB-A9216-1000UL,ABB-A9216-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HC6, HC71, CGI-150, C17orf25, GLOD4

Produktbeschreibung

Enables cadherin binding activity. Located in extracellular exosome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 35kDa
• NCBI: 51031
• UniProt: Q9HC38
• Reinheit: Affinity purification
• Sequenz: DNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
• Target-Kategorie: GLOD4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Endocrine Metabolism.

Bilder

Western blot analysis of various lysates using GLOD4 Rabbit pAb (A9216) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.