GLOD4 Rabbit pAb, Unconjugated

Product Overview

• Article Name: GLOD4 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9216
• Supplier Catalog Number: A9216
• Alternative Catalog Number: ABB-A9216-20UL,ABB-A9216-100UL,ABB-A9216-1000UL,ABB-A9216-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HC6, HC71, CGI-150, C17orf25, GLOD4

Product Description

Enables cadherin binding activity. Located in extracellular exosome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 35kDa
• NCBI: 51031
• UniProt: Q9HC38
• Purity: Affinity purification
• Sequence: DNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
• Target: GLOD4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Cancer,Tumor suppressors,Signal Transduction,Endocrine Metabolism.

Images

Western blot analysis of various lysates using GLOD4 Rabbit pAb (A9216) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.