ROGDI Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: ROGDI Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A9239
• Hersteller Artikelnummer: A9239
• Alternativnummer: ABB-A9239-20UL,ABB-A9239-100UL,ABB-A9239-500UL,ABB-A9239-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: KTZS, RAV2, ROGD1, ROGDI

Produktbeschreibung

Involved in brain development, neurogenesis, and odontogenesis of dentin-containing tooth. Located in nuclear envelope. Implicated in Kohlschutter-Tonz syndrome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 32kDa
• NCBI: 79641
• UniProt: Q9GZN7
• Reinheit: Affinity purification
• Sequenz: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGA
• Target-Kategorie: ROGDI
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat, ResearchArea: Kinase,Cell Biology Developmental Biology,Cell Cycle.

Bilder

Western blot analysis of various lysates using ROGDI Rabbit pAb (A9239) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.