ROGDI Rabbit pAb, Unconjugated

Product Overview

• Article Name: ROGDI Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9239
• Supplier Catalog Number: A9239
• Alternative Catalog Number: ABB-A9239-20UL,ABB-A9239-100UL,ABB-A9239-500UL,ABB-A9239-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KTZS, RAV2, ROGD1, ROGDI

Product Description

Involved in brain development, neurogenesis, and odontogenesis of dentin-containing tooth. Located in nuclear envelope. Implicated in Kohlschutter-Tonz syndrome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 32kDa
• NCBI: 79641
• UniProt: Q9GZN7
• Purity: Affinity purification
• Sequence: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGA
• Target: ROGDI
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse,Rat, ResearchArea: Kinase,Cell Biology Developmental Biology,Cell Cycle.

Images

Western blot analysis of various lysates using ROGDI Rabbit pAb (A9239) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.